Food
Nederlands
  • Thuis
  • Producten
    • Pla stro
    • Stro Pla
    • Eierrekje
    • Riet stro
    • Tarwestro
    • Bekerpapier
    • Eco Rietjes
    • Bio Rietjes
    • Papieren zak
    • Plasticfolie
    • Bekijk alle producten
  • Nieuws
  • Blog
  • Neem contact met ons op
  • Over ons

    Langdurige samenwerkingsrelatie met eerstelijnsmerken in binnen- en buitenland

    Bekijk alle producten

    Zorg voor nauwkeurige en handige producten van hoge kwaliteit

    Bekijk alle producten

    Geslaagd ISO- 9001- 2008 Internationale kwaliteitssysteemcertificering Andeu Ce-certificering

    Bekijk alle producten
    • Thuis
    • Nieuws
    • R&D/Leverage comes to K under new management, with big plans | Plastics News

      by admin on 2022-10-25 04:53:29

      Mold maker R&D/Leverage Co. came to K 2022 under new management that has big plans.

      The U.S.-based company was acquired in September by Adler Industrial Solutions Inc., as part of that firm's rollup in the tooling industry, and officials are looking for the K show to help bring that

      read more
    • Last Call with Marc Williams, owner of Piercing Emporium

      by admin on 2022-10-25 04:47:26

      Piercing Emporium owner Marc Williams has been piercing everything from babies’ ears to grown men’s eyebrows since the 1990s. When Massachusetts put regulations in place surrounding body art in 2000, his shop was the first in the city to obtain a state safety certification, and the studio

      read more
    • GRAPHIC: Teens escape handcuffs, flee abusive home, official says

      by admin on 2022-10-25 04:47:24

      CYPRESS, Texas (KTRK) - Teen twins in Texas, starving and beaten, got out of their house and went door to door begging for help, officials said.

      A woman answered a bizarre knock on the door at 5:30 a.m. Tuesday. Others in the neighborhood did not answer, some out of fright, but she did.

      read more
    • Residue level, occurrence characteristics and ecological risk of pesticides in typical farmland-river interlaced area of Baiyang Lake upstream, China | Scientific Reports

      by admin on 2022-10-25 04:32:56

      Thank you for visiting nature.com. You are using a browser version with limited support for CSS. To obtain the best experience, we recommend you use a more up to date browser (or turn off compatibility mode in Internet Explorer). In the meantime, to ensure continued sup

      read more
    • Universal Socket Joints Are a DIYer’s Secret Weapon

      by admin on 2022-10-25 04:30:48

      Our car experts choose every product we feature. We may earn money from the links on this page.

      This tiny tool is a big problem-solver. Rear Hub Bearing Assembly

      read more
    • Level's new Level Lock+ with Apple Home Key is smart lock perfection • TechCrunch

      by admin on 2022-10-25 04:30:47

      Smart lock startup Level has a new version of its lock available, and this one includes Apple Home Key out of the box. The new Level Lock+ is almost identical to its predecessor, the Level Lock Touch, in every other way — but the addition of Home Key takes what was already a super strong pro

      read more
    • Increasing Waste Generation & Waste Disposal Needs will Propel Garbage Bags Market to US$ 13.6 Bn by 2031, says Future Market Insights, Inc.

      by admin on 2022-10-25 04:30:46

      Ban on Single-use Plastics to drive the growth of Biodegradable Plastics. North America holds more than 20% of the market share. FMI expects global garbage bags market to grow at 5.8% CAGR through 2031

      NEWARK, Del, Oct. 12, 2022 (GLOBE NEWSWIRE) -- The global garbage bags market is expec

      read more
    • Harveys EPCOT 40th Anniversary Streamline Tote with Figment Tag Now Available at Creations Shop - WDW News Today

      by admin on 2022-10-25 04:30:46

      This post may contain affiliate links; please read the disclosure for more information.

      Today at the Creations Shop at EPCOT we found the long-awaited Harveys EPCOT 40th Anniversary bags including the Medium Streamline Tote bag. Alkyl Polyglucosides

      read more
    • Meet The 'Moparized' 2023 Fiat Fastback B-UV Coupé! - MoparInsiders

      by admin on 2022-10-25 04:17:36

      Mopar has gotten its hands on the all-new 2023 Fiat Fastback B-segment utility vehicle (UV) coupé. This new ‘Moparized’ show car, will showcase a majority of the new portfolio of accessories that Mopar will launch alongside the Fastback.

      Based on the ‘Limited Edition P

      read more
    • ‹
    • 1
    • 2
    • ...
    • 57
    • 58
    • 59
    • 60
    • 61
    • 62
    • 63
    • ...
    • 170
    • 171
    • ›

    Hot Menu

    • Thuis
    • Producten
    • Nieuws
    • Blog
    • FAQ
    • Over ons
    • Neem contact met ons op

    Partner Company

    • glyphosate ipa
    • 36v Golf Cart Lithium Battery
    • Milling Robotic Arm
    • Glamping Safari Tent
    • Bitcoin Miner S9
    • Home Styling
    • Stackable Dining Room Chairs
    • Multivitamin Premix
    Copyright © 2021 Dongguan Food Packaging Co., Ltd. Sitemap